DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and SPB1

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_009877.1 Gene:SPB1 / 850304 SGDID:S000000559 Length:841 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:69/222 - (31%)
Similarity:105/222 - (47%) Gaps:22/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYG-ILRPGDTVLECGA 88
            |.|.:|.|||            .|.|...|:...||.||:||:::|::||| .|.....|::..|
Yeast     3 KTQKKNSKGR------------LDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCA 55

  Fly    89 APGSWTQVAVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQDR 153
            |||||.|||.:....|        ..:..:|::....:|....|.. |.|:...:.:||..::..
Yeast    56 APGSWCQVASKLCPVN--------SLIIGVDIVPMKPMPNVITFQS-DITTEDCRSKLRGYMKTW 111

  Fly   154 KVNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRF 218
            |.:.||.|.|||.....:.|..:.:.|..:.|:.|:.........|.|::.:.|..||.....:.
Yeast   112 KADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQL 176

  Fly   219 YEKVKRVKPRASRGDSAEHFLVARNFK 245
            :|||:..||.|||..|||.|:|.:.||
Yeast   177 FEKVEATKPPASRNVSAEIFVVCKGFK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 63/212 (30%)
SPB1NP_009877.1 RlmE 1..206 CDD:223370 69/222 (31%)
DUF3381 236..383 CDD:403157
Spb1_C 621..835 CDD:400230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.