DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and AT4G25730

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_194303.2 Gene:AT4G25730 / 828678 AraportID:AT4G25730 Length:821 Species:Arabidopsis thaliana


Alignment Length:201 Identity:66/201 - (32%)
Similarity:99/201 - (49%) Gaps:14/201 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVERTNANGKQERAPQ 112
            |.|...|:...:|.|:::|||::|.||.:|.....||:..||||.|.||||         |:.|.
plant    11 DKYYRLAKERGFRSRASYKLLQLDAKYSLLHSAHAVLDLCAAPGGWMQVAV---------EKVPV 66

  Fly   113 GA-VFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQDRKV---NCVLSDMAPNATGVRMLD 173
            |: |..|||:....|.|.... ..|.|.:..:.::::.::...|   |.||.|.:||..|....:
plant    67 GSLVLGIDLVPILPVRGCVTM-TQDITRTECKSKIKQVMEQHGVSAFNLVLHDGSPNVGGAWAQE 130

  Fly   174 QESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVKPRASRGDSAEHF 238
            ..|...|..:.:|.|....|...:||.||:.:.|...:...:.|.:|||:..||.|||..|||.:
plant   131 AMSQNALVIDSVRLATEFLARNGNLVTKVFRSRDYNSVLYCLGRLFEKVEVFKPPASRSASAETY 195

  Fly   239 LVARNF 244
            ||...:
plant   196 LVGLKY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 66/201 (33%)
AT4G25730NP_194303.2 RlmE 6..204 CDD:223370 66/201 (33%)
DUF3381 236..382 CDD:288694
Spb1_C 599..788 CDD:285075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.