DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mrm2 and Ftsj3

DIOPT Version :10

Sequence 1:NP_650835.1 Gene:Mrm2 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_079586.1 Gene:Ftsj3 / 56095 MGIID:1860295 Length:838 Species:Mus musculus


Alignment Length:213 Identity:62/213 - (29%)
Similarity:101/213 - (47%) Gaps:16/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQV 96
            ||:...|:.       |.:...|:...||.||||||::::.::..|:....:|:..||||.|.||
Mouse     4 KGKVGKSRR-------DKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQV 61

  Fly    97 AVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQDRKVNCVLSD 161
            |.:....:        ..:..:||:....:|..... ..|.|:...::.||:.|:..||:.||:|
Mouse    62 AAKFMPVS--------SLIVGVDLVPIKPLPNVVTL-QEDITTERCRQALRKELKTWKVDVVLND 117

  Fly   162 MAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVK 226
            .|||.....:.|..|..:|....||.|....|.....:.||:.:.|...|.....:.:.:|:..|
Mouse   118 GAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWIFQQLFHRVQATK 182

  Fly   227 PRASRGDSAEHFLVARNF 244
            |:|||.:|||.|:|.:.|
Mouse   183 PQASRHESAEIFVVCQGF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mrm2NP_650835.1 RlmE 32..246 CDD:440062 62/213 (29%)
Ftsj3NP_079586.1 RlmE 1..200 CDD:440062 61/211 (29%)
DUF3381 231..398 CDD:463375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..367
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 453..482
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..639
Spb1_C 640..825 CDD:462264
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 802..838
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.