DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and mrm2

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001373504.1 Gene:mrm2 / 555586 ZFINID:ZDB-GENE-030131-5205 Length:240 Species:Danio rerio


Alignment Length:221 Identity:101/221 - (45%)
Similarity:142/221 - (64%) Gaps:0/221 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAA 89
            |:.|.:|||:|.:.:.||.|||:||:|:.|...||||||||||:|:||||.:|:||.||::||||
Zfish    18 KKTPLHLKGKSTADKRWLIRQLSDPFVKAAHEQNYRCRSAFKLIEMDDKYRLLKPGFTVIDCGAA 82

  Fly    90 PGSWTQVAVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQDRK 154
            ||:|:||||:|.|:.|:....|:|:|..||:||...:.||......|.||......|...|.:..
Zfish    83 PGAWSQVAVQRVNSTGESVDLPKGSVIGIDILHIFPLDGAQFLTNHDITSPSTHTALERLLPEAG 147

  Fly   155 VNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFY 219
            .:.:||||||||:|.|.||.|.:.::|..:|..|..:..|...|:.|.||.|....|::.:...:
Zfish   148 ADVILSDMAPNASGFRELDHERLVSMCLSMLDLADKVLRPGGSLICKYWDGGLAHMLQQRLFSAF 212

  Fly   220 EKVKRVKPRASRGDSAEHFLVARNFK 245
            :.|:.|||||||.:|||.|.:||..|
Zfish   213 QDVRTVKPRASRKESAELFFLARMLK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 96/211 (45%)
mrm2NP_001373504.1 RlmE 28..240 CDD:223370 96/211 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578454
Domainoid 1 1.000 172 1.000 Domainoid score I3681
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5907
Inparanoid 1 1.050 208 1.000 Inparanoid score I3669
OMA 1 1.010 - - QHG61324
OrthoDB 1 1.010 - - D1039414at2759
OrthoFinder 1 1.000 - - FOG0003458
OrthoInspector 1 1.000 - - oto38846
orthoMCL 1 0.900 - - OOG6_103441
Panther 1 1.100 - - LDO PTHR10920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1997
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.