DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mrm2 and Trm7-34

DIOPT Version :10

Sequence 1:NP_650835.1 Gene:Mrm2 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_650947.1 Gene:Trm7-34 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster


Alignment Length:201 Identity:58/201 - (28%)
Similarity:93/201 - (46%) Gaps:9/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVERTNANGKQERAPQ 112
            |.:...|:...:|.|||||||:.|:.:.:|......::..||||||:||..:|.......|...:
  Fly    10 DIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYEPLPPEEREK 74

  Fly   113 GAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQD----RKVNCVLSDMAPNATGVRMLD 173
            ..:.::||...     |.|.|.....:.::::...||:.:    .|...|:||.||::||:...|
  Fly    75 VKIIAVDLQGM-----APIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGMHDFD 134

  Fly   174 QESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVKPRASRGDSAEHF 238
            ......|....|..:..:.......|.|::......:|...:.||::.|...||.|||..|.|.|
  Fly   135 SYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSSIEAF 199

  Fly   239 LVARNF 244
            :|||.|
  Fly   200 VVAREF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mrm2NP_650835.1 RlmE 32..246 CDD:440062 58/201 (29%)
Trm7-34NP_650947.1 RlmE 1..205 CDD:440062 57/199 (29%)

Return to query results.
Submit another query.