DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and SPAPB17E12.10c

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001018225.1 Gene:SPAPB17E12.10c / 3361435 PomBaseID:SPAPB17E12.10c Length:301 Species:Schizosaccharomyces pombe


Alignment Length:263 Identity:38/263 - (14%)
Similarity:85/263 - (32%) Gaps:82/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KYAKQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLEC 86
            ::....|:..|..:..|.........:.::||                |:.::.:.:||..|::.
pombe    34 RFYSNPPKKTKKNTLISLRKSAETANEKFIEK----------------INKEHQLFKPGQIVVDL 82

  Fly    87 GAAPGSWTQVAVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGG----MDFTSSLAQKRLR 147
            |.|||.|:.:|.......|:        |.:.|::.......:::..|    |:....:|:..:|
pombe    83 GCAPGIWSTIAARHVGLFGR--------VIACDIIPCRLPENSSMIQGNILSMEIQLEIAKAAIR 139

  Fly   148 E---------------------------------ALQDRKVNCVLSDMAPNATGVR--------- 170
            .                                 .::|...:.::||:.|....|:         
pombe   140 SRNSFFRNQQDHNSASIPYLQSVFEEERDTKEKAKIEDLSADVIMSDLGPPFPMVQGFEFWISKL 204

  Fly   171 ------------MLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVK 223
                        :.|:.....|....|.||:....|....:.||.::..:.....|:...::.||
pombe   205 PYLAMQTNEHLAVKDELDSLYLAQAALLFAIKALKPDGIFLCKVLESSHLRSFAEDLSMCFKCVK 269

  Fly   224 RVK 226
            :::
pombe   270 KIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 36/250 (14%)
SPAPB17E12.10cNP_001018225.1 AdoMet_MTases 61..284 CDD:302624 35/236 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1997
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.