DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mrm2 and CG8939

DIOPT Version :10

Sequence 1:NP_650835.1 Gene:Mrm2 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster


Alignment Length:211 Identity:62/211 - (29%)
Similarity:97/211 - (45%) Gaps:15/211 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVER 100
            |.::...||:  |.:.:.|:....|.|:||||::::.|:|.|:.....|:..||||.|.|||   
  Fly     3 KKTKVGKTRK--DKFYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVA--- 62

  Fly   101 TNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGM--DFTSSLAQKRLREALQDRKVNCVLSDMA 163
                 ||.......|..:||.....:.|..   |:  |.|:...::.|.:.||..|.:.||.|.|
  Fly    63 -----KQNMPVSSIVIGVDLFPIRPIAGCI---GLVEDITTEKCRQSLTKELQSWKADVVLHDGA 119

  Fly   164 PNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVKPR 228
            ||.....:.|......|....|:.:..........|.||:.:.|...|...:.:.::||...||.
  Fly   120 PNVGRNWLYDAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPS 184

  Fly   229 ASRGDSAEHFLVARNF 244
            |||.:|||.|:|.:.:
  Fly   185 ASRKESAEIFVVCQGY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mrm2NP_650835.1 RlmE 32..246 CDD:440062 62/211 (29%)
CG8939NP_573099.1 RlmE 1..200 CDD:440062 62/209 (30%)
DUF3381 233..366 CDD:463375
Spb1_C 610..803 CDD:462264
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.