Sequence 1: | NP_650835.1 | Gene: | CG11447 / 42359 | FlyBaseID: | FBgn0038737 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001292397.1 | Gene: | ftsj3 / 321247 | ZFINID: | ZDB-GENE-030131-9828 | Length: | 838 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 64/202 - (31%) |
---|---|---|---|
Similarity: | 99/202 - (49%) | Gaps: | 11/202 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 TRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVERTNANGKQ 107
Fly 108 ERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQDRKVNCVLSDMAPNATGVRML 172
Fly 173 DQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVKPRASRGDSAEH 237
Fly 238 FLVARNF 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11447 | NP_650835.1 | RlmE | 35..246 | CDD:223370 | 64/202 (32%) |
ftsj3 | NP_001292397.1 | RlmE | 4..203 | CDD:223370 | 64/202 (32%) |
DUF3381 | 233..377 | CDD:288694 | |||
Spb1_C | 624..819 | CDD:285075 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |