DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and Mrm2

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001100595.1 Gene:Mrm2 / 304323 RGDID:1305944 Length:246 Species:Rattus norvegicus


Alignment Length:239 Identity:99/239 - (41%)
Similarity:143/239 - (59%) Gaps:12/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RLLHTEIGGKYAKQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGIL 77
            |.|||.:         .:.|||:.:...||.|.|.||:|:.|:..:|||||||||||:::|:.||
  Rat    15 RRLHTAV---------CHYKGRTGAEHLWLMRHLKDPFVKAAKAESYRCRSAFKLLEMNEKHHIL 70

  Fly    78 RPGDTVLECGAAPGSWTQVAVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLA 142
            |||..||:||||||:|:||||:..||.|....:|.|.|..:||||...:.|||.....|.|....
  Rat    71 RPGLRVLDCGAAPGAWSQVAVQSVNATGADSSSPMGFVLGVDLLHMFPLAGATFLCPADVTDPRT 135

  Fly   143 QKRLREALQDRKVNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGD 207
            .:|:.|.|..|:.:.:||||||||||:|.||.:.:.:||..::..|:.:..|...|:.|.|....
  Rat   136 FQRILELLPRRRADVILSDMAPNATGIRDLDHDRLISLCLTLVDMAVDILHPGGTLLCKTWAGSK 200

  Fly   208 VPKLERDMLRFYEKVKRVKPRASRGDSAEHFLVARNF---KGAT 248
            ...|::.:.:.:...:.|||.|||.:|||.:|:|..:   ||:|
  Rat   201 SHLLQKRLAQEFRSTRVVKPEASRKESAEVYLLATQYHGRKGST 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 89/213 (42%)
Mrm2NP_001100595.1 RlmE 33..241 CDD:223370 89/207 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338842
Domainoid 1 1.000 160 1.000 Domainoid score I3978
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5907
Inparanoid 1 1.050 186 1.000 Inparanoid score I3840
OMA 1 1.010 - - QHG61324
OrthoDB 1 1.010 - - D1039414at2759
OrthoFinder 1 1.000 - - FOG0003458
OrthoInspector 1 1.000 - - oto95882
orthoMCL 1 0.900 - - OOG6_103441
Panther 1 1.100 - - LDO PTHR10920
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1997
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.