DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and Ftsj3

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001012014.1 Gene:Ftsj3 / 303608 RGDID:1307110 Length:829 Species:Rattus norvegicus


Alignment Length:213 Identity:62/213 - (29%)
Similarity:101/213 - (47%) Gaps:16/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQV 96
            ||:...|:.       |.:...|:...||.||||||::::.::..|:....:|:..||||.|.||
  Rat     4 KGKVGKSRR-------DKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQV 61

  Fly    97 AVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQDRKVNCVLSD 161
            |.:....:        ..:..:||:....:|..... ..|.|:...::.||:.|:..||:.||:|
  Rat    62 AAKFMPVS--------SLIVGVDLVPIKPLPNVVTL-QEDITTERCRQALRKELKTWKVDVVLND 117

  Fly   162 MAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVK 226
            .|||.....:.|..|..:|....||.|....|.....:.||:.:.|...|.....:.:.:|:..|
  Rat   118 GAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWIFQQLFHRVQATK 182

  Fly   227 PRASRGDSAEHFLVARNF 244
            |:|||.:|||.|:|.:.|
  Rat   183 PQASRHESAEIFVVCQGF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 60/210 (29%)
Ftsj3NP_001012014.1 RlmE 8..203 CDD:223370 60/209 (29%)
DUF3381 232..>329 CDD:403157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..367
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..508
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 528..634
Spb1_C 628..823 CDD:400230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 794..829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.