DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and MRM2

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_037525.1 Gene:MRM2 / 29960 HGNCID:16352 Length:246 Species:Homo sapiens


Alignment Length:248 Identity:99/248 - (39%)
Similarity:147/248 - (59%) Gaps:15/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLVFTGNCV-FKRL-LHTEIGGKYAKQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMNYRCRS 63
            ::||    || |:|. .|| :|.:        .|.|:.:...||||.|.||:|:.|::.:|||||
Human     5 LKLV----CVSFQRQGFHT-VGSR--------CKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRS 56

  Fly    64 AFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVERTNANGKQERAPQGAVFSIDLLHFHAVPG 128
            ||||||:::::.|||||..||:||||||:|:||||::.||.|....:|.|.|..:||||...:.|
Human    57 AFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEG 121

  Fly   129 ATIFGGMDFTSSLAQKRLREALQDRKVNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSA 193
            ||.....|.|.....:|:.|.|..|:.:.:||||||||||.|.||.:.:.:||..:|.....:..
Human   122 ATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQ 186

  Fly   194 PQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVKPRASRGDSAEHFLVARNFKG 246
            |....:.|.|......:|:|.:...::.|:.:||.|||.:|:|.:.:|..:.|
Human   187 PGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHG 239

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 87/210 (41%)
MRM2NP_037525.1 RlmE 33..241 CDD:223370 88/207 (43%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000269|Ref.9 83..86 2/2 (100%)