DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and spb1

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_593129.1 Gene:spb1 / 2542112 PomBaseID:SPAC1687.11 Length:802 Species:Schizosaccharomyces pombe


Alignment Length:221 Identity:64/221 - (28%)
Similarity:95/221 - (42%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAA 89
            |.|.:..|||            .|.:.:.|:...||.|:||||::::.||..|.....:::..||
pombe     3 KSQKKTAKGR------------LDKWYKLAKEQGYRSRAAFKLVQLNQKYSFLEKAKVIIDLCAA 55

  Fly    90 PGSWTQVAVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQDRK 154
            ||.|.|||.:...        |...:..:||.....:|....| ..|.||...:.:||..|:..|
pombe    56 PGGWLQVASKTCK--------PGSLIVGVDLAPIKPIPNCHTF-VEDITSDKCRSQLRGYLKTWK 111

  Fly   155 VNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFY 219
            .:.||.|.|||.....:.|......|....::.|..........|.||:.:.|...|.....:.:
pombe   112 ADVVLHDGAPNVGSAWLQDAYGQAQLVLMSMKLACEFLVAGGTFVTKVFRSRDYNNLLWVFKQLF 176

  Fly   220 EKVKRVKPRASRGDSAEHFLVARNFK 245
            .||:..||.:||..|||.|:|.|.:|
pombe   177 NKVEATKPPSSRNVSAEIFVVCRGYK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 59/211 (28%)
spb1NP_593129.1 RlmE 1..205 CDD:223370 64/221 (29%)
DUF3381 235..385 CDD:288694
Spb1_C 588..798 CDD:285075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.