DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and mrm2

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_596444.1 Gene:mrm2 / 2540444 PomBaseID:SPBC2G2.15c Length:218 Species:Schizosaccharomyces pombe


Alignment Length:220 Identity:67/220 - (30%)
Similarity:110/220 - (50%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVE 99
            ||:...|..::..|.|.:|:::.|:|.|:|:||:|::.||..:...|.|::.|.|||||:|||.:
pombe     4 SKTLFSWAAKRSKDFYRKKSKIDNFRSRAAYKLIELNSKYRFINKEDVVIDVGFAPGSWSQVAKK 68

  Fly   100 RTNANGKQERAPQGAVFSIDLLHFHAVPGA-TIFGGMDFTSSLAQ--KRLR--------EALQDR 153
            .....||        |..||:.|.....|. .|:|.:...::|.:  :.||        :::..|
pombe    69 LVGNKGK--------VIGIDIQHIAPPEGVLPIYGDIRDPNTLTKLFEALRLLHEPNTNDSIDCR 125

  Fly   154 KVNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVW---DNGDVPKLERDM 215
            .|:.|:|||...|||:|:.|......||...|..||.........:.|.:   ::.|:..|.:..
pombe   126 VVDAVISDMLHKATGIRIRDHALSMELCASALHVALTFLKSNGSFICKFYMGDEDADLQNLLKSH 190

  Fly   216 LRFYEKVKRVKPRASRGDSAEHFLV 240
            .||   |:.:||:||..:|.|.:.|
pombe   191 FRF---VQVMKPKASLKESREAYFV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 67/220 (30%)
mrm2NP_596444.1 RlmE 4..218 CDD:223370 67/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61324
OrthoFinder 1 1.000 - - FOG0003458
OrthoInspector 1 1.000 - - oto100653
orthoMCL 1 0.900 - - OOG6_103441
Panther 1 1.100 - - LDO PTHR10920
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1732
SonicParanoid 1 1.000 - - X1997
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.