DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11447 and mrm2

DIOPT Version :9

Sequence 1:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_012826659.2 Gene:mrm2 / 100495952 XenbaseID:XB-GENE-997867 Length:277 Species:Xenopus tropicalis


Alignment Length:236 Identity:102/236 - (43%)
Similarity:143/236 - (60%) Gaps:11/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NCVFKRLLHTEIGGKYAKQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDD 72
            |.|.:|.||......         |.|:.:.|.||.||:.||||.:|:..||||||||||||||:
 Frog    45 NVVSRRSLHVTCALD---------KSRTAAEQRWLARQMKDPYVREAQTHNYRCRSAFKLLEIDN 100

  Fly    73 KYGILRPGDTVLECGAAPGSWTQVAVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDF 137
            |:.||:||..|::||||||:|:|||||:.|:.|:...|..|.|..:|||:...:.||......|.
 Frog   101 KHHILQPGHHVIDCGAAPGAWSQVAVEKVNSLGRDSAASAGFVVGVDLLNIAPLDGAVFLSNSDI 165

  Fly   138 TSSLAQKRLREALQDRKVNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKV 202
            |....||::...|...|.:.:||||||||||:|.||.:.:.|:|..:|..:..:.......:.||
 Frog   166 TDFDTQKKIISVLPSGKADVILSDMAPNATGIRDLDHQRLVNMCLSLLELSERVLLSGGTFLCKV 230

  Fly   203 WDNGDVPKLERDMLR-FYEKVKRVKPRASRGDSAEHFLVAR 242
            ||..:: .|.||.|| .::.|:.|||:|||.:|||.:|:|:
 Frog   231 WDGSEI-NLVRDRLRQRFQDVRTVKPKASRMESAEVYLLAK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11447NP_650835.1 RlmE 35..246 CDD:223370 95/209 (45%)
mrm2XP_012826659.2 RlmE 67..270 CDD:223370 94/203 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3929
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5907
Inparanoid 1 1.050 192 1.000 Inparanoid score I3740
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1039414at2759
OrthoFinder 1 1.000 - - FOG0003458
OrthoInspector 1 1.000 - - oto102620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1997
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.