DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mrm2 and ftsj3

DIOPT Version :10

Sequence 1:NP_650835.1 Gene:Mrm2 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_012822455.1 Gene:ftsj3 / 100145257 XenbaseID:XB-GENE-5797493 Length:850 Species:Xenopus tropicalis


Alignment Length:224 Identity:64/224 - (28%)
Similarity:103/224 - (45%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKYAKQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLE 85
            ||.||      .|:|:.          |.:...|:...||.||||||::::.|:..|.....:::
 Frog     2 GKKAK------VGKSRK----------DKFYHLAKETGYRSRSAFKLIQLNRKFQFLPKARALVD 50

  Fly    86 CGAAPGSWTQVAVERTNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREAL 150
            ..||||.|.|||.:....:        ..:..:||:....:|..... ..|.|:...::.:|:.|
 Frog    51 LCAAPGGWLQVAAKFMPIS--------SLIIGVDLVPIKPIPKVLTL-QEDITTEACRQTVRKHL 106

  Fly   151 QDRKVNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDM 215
            |..|.:.||:|.|||.......|..|..:|....||.|....:.....:.|::.:.|...|...:
 Frog   107 QTWKADVVLNDGAPNVGANWTHDAFSQVHLSLMALRLACDCLSRGGWFITKIFRSSDYQSLLWIL 171

  Fly   216 LRFYEKVKRVKPRASRGDSAEHFLVARNF 244
            .:|::||...||:|||.:|||.|:|.:.|
 Frog   172 QQFFKKVNSTKPQASRSESAEIFVVCQGF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mrm2NP_650835.1 RlmE 32..246 CDD:440062 60/213 (28%)
ftsj3XP_012822455.1 RlmE 1..200 CDD:440062 63/222 (28%)
DUF3381 234..371 CDD:463375
Spb1_C 659..850 CDD:462264
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.