DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICU3 and Micu2

DIOPT Version :9

Sequence 1:NP_001262741.1 Gene:MICU3 / 42357 FlyBaseID:FBgn0038735 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_082919.1 Gene:Micu2 / 68514 MGIID:1915764 Length:432 Species:Mus musculus


Alignment Length:468 Identity:169/468 - (36%)
Similarity:249/468 - (53%) Gaps:87/468 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GRSARFSSSSSQMGRIPGHKTRRLLTIVGGSAV----SLAALAAFIKLRSAENPVNAVSLKRRMR 87
            ||||..::.        |.:.||.|. .|..||    .|||..|.:.|..|....:...:|...|
Mouse     6 GRSAWLAAW--------GGRLRRGLA-AGRRAVPTRGPLAAAVAGVALAGAGAAWHHGRVKAAAR 61

  Fly    88 DDSELENV---------KLTARERRFIKFASVEYDDQLYMTPQDFLDSVVEQEPRPRLKRRQLSS 143
            :.|...:.         ||:.|::||::|:|:|:|.:.||||:|||.||:.::...:...::|:.
Mouse    62 EGSRTVSAQKNYLGPIEKLSLRKQRFMQFSSLEHDGEYYMTPRDFLFSVMFEQVERKTLVKKLAK 126

  Fly   144 DEVDKYKENTPALKKGSTRLFRNLRDKGIVSYTEYLFLLSILTKPKSGFRIAFNMFDTDGNQRVD 208
            .:::.........:.||| .||:|.|||::|||||||||:|||||.|||.:||.|.|.|||:.::
Mouse   127 KDIEDVLSGIQTARCGST-FFRDLGDKGVISYTEYLFLLTILTKPHSGFHVAFKMLDVDGNEMIE 190

  Fly   209 KDEFLVIISILAGALKDTQNVDPQTKRILSRLVSYDEQSQMTKPMAVPQAKRGIMERIFSGAWKE 273
            :.||:.                      |.:::|..:..:..|                      
Mouse   191 RKEFVK----------------------LQKIISKQDGFKTVK---------------------- 211

  Fly   274 KHGEQEPEEELATPTPLEQNYVNDGEGLQRRHMVATTLQLHFFGKRGTGVINYDNFYRFMDNLQT 338
                 ..|.|...||..|..             |.||||:.||||||...::|..|.|||:||||
Mouse   212 -----TNETEYQDPTVKEPG-------------VNTTLQVRFFGKRGEKKLHYKEFRRFMENLQT 258

  Fly   339 EVLELEFHEFSKGNSVISELDFAKILLRYTYLATDEYDVFLERLLERVKDEKGISFHDFRDFCHF 403
            ||.|:||.:||||.:.:.:.|||:.||.:|  .|:..|::...:.|::...:.||..:|:.||||
Mouse   259 EVQEMEFLQFSKGLNFMRKEDFAEWLLFFT--NTENKDIYWRNVREKLSVGESISLDEFKSFCHF 321

  Fly   404 LNNLDDFTIAMRMYTLADRAISKDEFSRAVKICTGYKLSPHLIDTVFAIFDADGDGLLSYKEFIA 468
            ..:|:||.|||:|::||.|.:...||.||||:.||.:||.:|:||||.|||.|||..||:.||:.
Mouse   322 TTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELSDNLLDTVFKIFDLDGDECLSHGEFLG 386

  Fly   469 IMKDRLHRGFKVS 481
            ::|:|:|||..||
Mouse   387 VLKNRMHRGLWVS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICU3NP_001262741.1 EF-hand_7 421..470 CDD:290234 26/48 (54%)
EF-hand_8 424..473 CDD:290545 26/48 (54%)
Micu2NP_082919.1 EF-hand_8 345..391 CDD:290545 26/45 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 175 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12294
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.