DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and FGF16

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_003859.1 Gene:FGF16 / 8823 HGNCID:3672 Length:207 Species:Homo sapiens


Alignment Length:154 Identity:58/154 - (37%)
Similarity:83/154 - (53%) Gaps:16/154 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 NSSSSNTPISNLD--RNER-----------STVPQSHLAWTSRKIQLYIKNRI-LQILRDGVVNG 270
            :||..|.|:::..  .|||           |....:||....|:.|||.:... |:|..:|.|:|
Human    19 SSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHG 83

  Fly   271 TQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYS 335
            |:.::|.|.||:..::.||.|.::.|.:.|||.|:..|..||||..|.:|||.|......||||:
Human    84 TRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYA 148

  Fly   336 STY--HSQARRVFYLALNGSGQPR 357
            ||.  ||.:.|.:|:|||..|.||
Human   149 STLYKHSDSERQYYVALNKDGSPR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 48/114 (42%)
FGF16NP_003859.1 FGF 61..187 CDD:395115 48/112 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8338
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm41236
orthoMCL 1 0.900 - - OOG6_117027
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.