DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf20

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_085113.2 Gene:Fgf20 / 80857 MGIID:1891346 Length:211 Species:Mus musculus


Alignment Length:165 Identity:61/165 - (36%)
Similarity:88/165 - (53%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LDRNER---STVPQSHLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFTILQRSTVDVGRI 291
            |:|..|   .:|..:||....|:.|||.:... ||||.||.|.||:.::|.|.||:..:|.||.:
Mouse    44 LERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLV 108

  Fly   292 KLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTY--HSQARRVFYLALNGSG 354
            .::.|.:.|||.|:..|..|||:..|.:|:|.|......||||||..  |....|.:::|||..|
Mouse   109 SIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDG 173

  Fly   355 QPRRTQIPASRSLGKLSTYTNAITETVPQERVEQL 389
            .||    ..:|| .:...:|:.:...|..|||.:|
Mouse   174 TPR----DGARS-KRHQKFTHFLPRPVDPERVPEL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 50/131 (38%)
Fgf20NP_085113.2 FGF 65..191 CDD:395115 50/130 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8324
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5855
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm43297
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.