DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf12a

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_005163295.1 Gene:fgf12a / 777735 ZFINID:ZDB-GENE-050221-6 Length:257 Species:Danio rerio


Alignment Length:270 Identity:58/270 - (21%)
Similarity:109/270 - (40%) Gaps:54/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 SIRHQNQQQQKKHHHHHQQQQQQQHQQQQPMSPADNNFIG--SKSKRLSNPRSSLNINSSSSNTP 227
            |:..|.:|.::.:.......:::....:.|.|..:.:|:|  ||.:..|..:..:.....:.:.|
Zfish     7 SLIRQKRQARESNSDRVSASKRRPSPSKDPRSLCERHFLGVFSKVRFCSGKKRPVRRRPDAPSKP 71

  Fly   228 ISNLDRNERSTVPQSHLAWTSRK---IQLYIKNRI----------LQILRDGVVNGTQDENSEFT 279
                        ||     .|||   ::..:|..:          ||:..||.::|.:||||::|
Zfish    72 ------------PQ-----VSRKGVRLEPQLKGIVTRLFSQQGFYLQMQPDGSIDGIKDENSDYT 119

  Fly   280 ILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQ--A 342
            :.....|.:..:.:|.|....|:.|:..|..|.|:.||.:|.|.|::....|..||||.:.|  :
Zfish   120 LFNLIPVGLRVVAIQGVKAGFYIGMNGEGFLYSSEMFTPECKFKESVFENYYVIYSSTMYRQQES 184

  Fly   343 RRVFYLALNGSGQPRRTQIPASRSLGKLSTYTNAITETVPQER-----VEQLIAKNFGANRVKHG 402
            .|.::|.|...||..:               .|.:.:|.|...     :|..:.:....:.::..
Zfish   185 GRAWFLGLTKEGQVMK---------------GNRVKKTKPSSHFVPRPIEVCMYREPSLHEIEEK 234

  Fly   403 VRQLCDTGKP 412
            .|....:|.|
Zfish   235 QRSRKSSGTP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 38/143 (27%)
fgf12aXP_005163295.1 FGF 86..216 CDD:214665 38/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.