DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf10b

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001039323.1 Gene:fgf10b / 751792 ZFINID:ZDB-GENE-060828-1 Length:187 Species:Danio rerio


Alignment Length:167 Identity:49/167 - (29%)
Similarity:88/167 - (52%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LNINSSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLY-IKNRILQILRDGVVNGTQDENSEFTI 280
            |.::||:|.   |...|:.||.|   ||....|:.:|: .:...|:|.:||.||||:.|:..::|
Zfish    33 LRVSSSAST---STSGRHARSYV---HLQGDVRQRRLFSFQKFFLRIGKDGKVNGTKSEDDPYSI 91

  Fly   281 LQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARRV 345
            |:.::||||.:.::.:.:.|||.:...|..:|.:::..:|...|.:....||||:|......:|.
Zfish    92 LEITSVDVGVVAIRGLGSNLYLAISKKGELFGVRNYGTNCRLKERIEENGYNTYASAKWKNNKRQ 156

  Fly   346 FYLALNGSGQPRRTQIPASRSLGKLSTYTNAITETVP 382
            .:::|:..|:|.|         |:.:...|..|..:|
Zfish   157 IFVSLSAHGRPLR---------GRKNRRKNTATHFLP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 35/129 (27%)
fgf10bNP_001039323.1 FGF 59..183 CDD:278592 37/132 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.