DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf21

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001038789.1 Gene:fgf21 / 724048 ZFINID:ZDB-GENE-060623-2 Length:194 Species:Danio rerio


Alignment Length:188 Identity:46/188 - (24%)
Similarity:74/188 - (39%) Gaps:45/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 HLAWTS---------------RKIQLYIKNRILQILRDGVVNGTQDENSEFTILQRSTVDVGRIK 292
            ||.|..               |:..||.....|::..||.|.|:.::|.. .:|:..:|..|...
Zfish    15 HLRWCMYVPAQNVLLQFGTQVRERLLYTDGLFLEMNPDGSVKGSPEKNLN-CVLELRSVKAGETV 78

  Fly   293 LQSVATCLYLCMDACGVPYGSKDFTD-DCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSGQP 356
            :||.||.||||:|......|...::. ||.|.|.: |..|:.:.|.:                  
Zfish    79 IQSAATSLYLCVDDQDKLKGQHHYSALDCTFQELL-LDGYSFFLSPH------------------ 124

  Fly   357 RRTQIPASRSLGKLSTYTNAITETVPQERVEQLIAKNFGANRVKHGVRQL-CDTGKPL 413
              |.:|.| .|.|...:.|.::..:|..|     |::.....||..::.: .|:..||
Zfish   125 --TNLPVS-LLSKRQKHGNPLSRFLPVSR-----AEDSRTQEVKQYIQDINLDSDDPL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 34/144 (24%)
fgf21NP_001038789.1 FGF 38..149 CDD:294048 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.