DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf16

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001035497.1 Gene:fgf16 / 692065 ZFINID:ZDB-GENE-060427-3 Length:203 Species:Danio rerio


Alignment Length:184 Identity:63/184 - (34%)
Similarity:91/184 - (49%) Gaps:20/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 NTPISNLDRNER-----------STVPQSHLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSE 277
            |.|:|: ..|||           |.....||....|:.|||.:... |:|..:|.|:||:.::|.
Zfish    23 NVPLSD-GLNERLGLIEGRLQRGSLTDFGHLKGILRRRQLYCRTGFQLEIFPNGTVHGTRQDHSR 86

  Fly   278 FTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTY--HS 340
            |.||:..::.||.:.::.|...|||.|:..|..||||..|.:|||.|......||||:||.  |:
Zfish    87 FGILEFISLAVGLVSIRGVDAGLYLGMNEKGELYGSKKLTAECVFREQFEENWYNTYASTLFKHA 151

  Fly   341 QARRVFYLALNGSGQPRRTQIPASRSLGKLSTYTNAITETVPQERVEQLIAKNF 394
            ...|.:|:|||..|.||.    .||: .|....|:.:...|..|::.|...:.|
Zfish   152 DTGRYYYVALNKDGSPRE----GSRT-KKHQKLTHFLPRPVEIEKIPQAYRELF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 50/131 (38%)
fgf16NP_001035497.1 FGF 55..185 CDD:214665 50/134 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm24229
orthoMCL 1 0.900 - - OOG6_117027
Panther 1 1.100 - - O PTHR11486
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.