powered by:
Protein Alignment bnl and Fgf22
DIOPT Version :9
Sequence 1: | NP_732452.1 |
Gene: | bnl / 42356 |
FlyBaseID: | FBgn0014135 |
Length: | 770 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_030101088.1 |
Gene: | Fgf22 / 67112 |
MGIID: | 1914362 |
Length: | 262 |
Species: | Mus musculus |
Alignment Length: | 72 |
Identity: | 20/72 - (27%) |
Similarity: | 38/72 - (52%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 243 HLAWTSRKIQLYIKNR-ILQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDA 306
||....|..:|:.... .|::...|.|.||:..:.:.:|::..:|.||.:.:::|.:..|:.|:.
Mouse 26 HLEGDVRWRRLFSSTHFFLRVDLGGRVQGTRWRHGQDSIVEIRSVRVGTVVIKAVYSGFYVAMNR 90
Fly 307 CGVPYGS 313
.|..|||
Mouse 91 RGRLYGS 97
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
bnl | NP_732452.1 |
FGF |
247..376 |
CDD:214665 |
18/68 (26%) |
Fgf22 | XP_030101088.1 |
FGF |
34..>97 |
CDD:381781 |
15/62 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
83 |
1.000 |
Domainoid score |
I8324 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3885 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000361 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm43297 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11486 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.910 |
|
Return to query results.
Submit another query.