DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf23

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_073148.1 Gene:Fgf23 / 64654 MGIID:1891427 Length:251 Species:Mus musculus


Alignment Length:118 Identity:37/118 - (31%)
Similarity:60/118 - (50%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFT-DDCVFN 323
            |||.|||.|:||..: :.::.|..::.|.|.:.:....|..:||||..|..:||..|: ::|.|.
Mouse    53 LQIHRDGHVDGTPHQ-TIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFR 116

  Fly   324 ENMGLQN-YNTYSSTYH------SQARRVFYLALNGSGQP-------RRTQIP 362
            : ..|:| |:.|.|..|      .:|:|:|.   .|:..|       ||.::|
Mouse   117 Q-WTLENGYDVYLSQKHHYLVSLGRAKRIFQ---PGTNPPPFSQFLARRNEVP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 37/118 (31%)
Fgf23NP_073148.1 FGF 41..160 CDD:412137 34/111 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..251
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.