DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf20b

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001034261.1 Gene:fgf20b / 564770 ZFINID:ZDB-GENE-060117-5 Length:208 Species:Danio rerio


Alignment Length:183 Identity:62/183 - (33%)
Similarity:93/183 - (50%) Gaps:9/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LNINSSSSNTPISNLDRNERST-VPQSHLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFT 279
            |..|....|..:...:|..||| ...:||....|:.|||.:... |:||.||.|.||:.::|.|.
Zfish    29 LGENLGLLNDHLFPAERLSRSTSADLTHLKGILRRRQLYCRTGFHLEILPDGSVQGTRKDHSRFG 93

  Fly   280 ILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARR 344
            ||:..::.||.|.::.|.:.|||.|:..|..|||:..|.:|||.|......||||||..:....|
Zfish    94 ILEFISLAVGLISIRGVDSGLYLGMNDKGELYGSEKLTAECVFREQFEENWYNTYSSNLYKHGER 158

  Fly   345 --VFYLALNGSGQPRRTQIPASRSLGKLSTYTNAITETVPQERVEQLIAKNFG 395
              .:::|||..|.||    ..::| .:...:|:.:...|..|:|.:|..:..|
Zfish   159 GARYFVALNKDGTPR----DGTKS-RRHQKFTHFLPRPVDPEKVPELYKEVLG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 48/131 (37%)
fgf20bNP_001034261.1 FGF 60..190 CDD:214665 48/134 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.