DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf2

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_062178.1 Gene:Fgf2 / 54250 RGDID:2609 Length:154 Species:Rattus norvegicus


Alignment Length:137 Identity:42/137 - (30%)
Similarity:63/137 - (45%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLYIKNR--ILQILRDGVVNGTQDENSEFTILQR 283
            ::.|.|.:..|..:.....|..|.....|   ||.||.  .|:|..||.|:|.::::.....||.
  Rat     2 AAGSITSLPALPEDGGGAFPPGHFKDPKR---LYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQL 63

  Fly   284 STVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARRVFYL 348
            ...:.|.:.::.|....||.|...|....||..|::|.|.|.:...|||||.|..:|.    :|:
  Rat    64 QAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSS----WYV 124

  Fly   349 ALNGSGQ 355
            ||..:||
  Rat   125 ALKRTGQ 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 37/111 (33%)
Fgf2NP_062178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/17 (18%)
FGF 28..148 CDD:395115 37/111 (33%)
Heparin-binding. /evidence=ECO:0000250 127..143 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.