DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf14

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001012382.1 Gene:fgf14 / 497642 ZFINID:ZDB-GENE-060506-1 Length:248 Species:Danio rerio


Alignment Length:222 Identity:67/222 - (30%)
Similarity:107/222 - (48%) Gaps:28/222 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 QQQQQHQQQQPMSPADNNFIGS--KSKRLSNPRSSLNINSSSSNTPISNL-DRNERSTVPQSHLA 245
            :|::|.::|....|:.|....|  |:|.|.|.    |:....|...|..| .|..|...||....
Zfish    11 RQKRQAREQHIDRPSTNRRRKSPNKNKGLCNG----NLVDIFSKVRIFGLRKRRLRRQDPQLKGI 71

  Fly   246 WTSRKIQLYIK-NRILQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGV 309
            .|    :||.: ...||:..||.::||:|::|..::.....|.:..:.:|||.|.||:.|:..|.
Zfish    72 VT----RLYCRQGYYLQMNPDGSLDGTKDDSSNSSLFNLIPVGLRVVAIQSVKTGLYIAMNGEGH 132

  Fly   310 PYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQ--ARRVFYLALNGSGQP------RRTQIPASRS 366
            .|.|:.||.:|.|.|::....|..|||..:.|  :.|.::|.||..||.      ::|: ||:..
Zfish   133 LYTSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKDGQAMKGNRVKKTK-PAAHF 196

  Fly   367 LGK---LSTY----TNAITETVPQERV 386
            |.|   ::.|    .:.:.||||:..|
Zfish   197 LPKPLEVAMYREPSLHDVGETVPKPAV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 44/144 (31%)
fgf14NP_001012382.1 FGF 72..197 CDD:395115 41/129 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.