DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf11a

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001012380.1 Gene:fgf11a / 497640 ZFINID:ZDB-GENE-050221-5 Length:248 Species:Danio rerio


Alignment Length:287 Identity:72/287 - (25%)
Similarity:118/287 - (41%) Gaps:63/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 QQQQPMSPADNNFIGSKSKRLSNPRSSLNINSSSSNTPISNL-------DRNERSTVPQSHLAWT 247
            |:::...|..|..|.:|.|..  |:|:.::........||.:       .:.|:...||.....|
Zfish    11 QRREVKDPKANRQISNKRKPC--PKSNKSLCQKQILILISKVRLCGSRGRKLEKRPEPQLKGIVT 73

  Fly   248 SRKIQLYIKNRI-LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPY 311
                :||.::.. ||:|.||.::||:||||.|.:.....|.:..:.:||..|.||:.|::.|..|
Zfish    74 ----RLYCRHGFYLQMLPDGTLDGTKDENSSFLLFNLIPVGLRIVAIQSTKTGLYIGMNSEGYLY 134

  Fly   312 GSKDFTDDCVFNENMGLQNYNTYSSTYH--SQARRVFYLALNGSGQPRRTQIPASRSLGKLSTYT 374
            .|:.||.:|.|.|.:....|.||||..:  :|:.|.:|:.:|..||..:                
Zfish   135 TSEHFTPECKFKECVFENYYVTYSSILYRQTQSGRAWYIGINRDGQVMK---------------- 183

  Fly   375 NAITETVPQERVEQLIAKNFGANRVK--HGVRQLCDTGKPLIELID-VARFKAPP-HCSSNTSGS 435
                                 .||||  .|....      |.:||: :|.::.|. |..:..|..
Zfish   184 ---------------------GNRVKKTKGAAHF------LPKLIEGIAMYREPSLHDVAEQSPP 221

  Fly   436 SSSISSSSSSSSKSSSNSSSSYVPVSA 462
            ..:..:|.|...|:|.......||.::
Zfish   222 RKTAKTSDSPVHKNSKKEHLLTVPTAS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 41/131 (31%)
fgf11aNP_001012380.1 FGF 72..197 CDD:278592 46/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.