DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf18b

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001012379.1 Gene:fgf18b / 497639 ZFINID:ZDB-GENE-050221-4 Length:213 Species:Danio rerio


Alignment Length:162 Identity:35/162 - (21%)
Similarity:68/162 - (41%) Gaps:15/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 NPRSSLNINSSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLYIK--NRILQILRDGVVNGTQDE 274
            :|...|.:::.:....:.| ....|..:.:.|    .|..|:|.:  .:.:|:|...:....:|.
Zfish    21 SPLQVLAVDNVNFGVHVEN-QTGVRDGLSRKH----HRVYQIYSRTSGKHVQVLGKKITAMGEDG 80

  Fly   275 NSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKD--FTDDCVFNENMGLQNYNTYSST 337
            :....::..:.....:::::...|..||||:..|...|.||  ....|||.|.|...||..:.|.
Zfish    81 DKYAQLVVEADTFGSQVRIRGKETNYYLCMNRKGKLIGKKDSSVNGGCVFIEIMLENNYTAWMSA 145

  Fly   338 YHSQARRVFYLALNGSGQPRR--TQIPASRSL 367
            ::..    :|:.....|:|||  ..:|..|.:
Zfish   146 HYVG----WYVGFTKKGRPRRGPNTLPNQRDV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 30/127 (24%)
fgf18bNP_001012379.1 FGF 53..176 CDD:278592 30/125 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.