DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf7

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001011366.1 Gene:fgf7 / 496833 XenbaseID:XB-GENE-488183 Length:194 Species:Xenopus tropicalis


Alignment Length:144 Identity:45/144 - (31%)
Similarity:72/144 - (50%) Gaps:10/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SLNINSSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLYIKNR-ILQILRDGVVNGTQDENSEFT 279
            ::|:|.||......:.|..|...|         |..:|:.:.: .|.|.:.|.|.||||.|:.|:
 Frog    41 AINVNCSSPERHTRSYDYMEGGDV---------RIRKLFCRTQWYLWIDKRGNVKGTQDPNNSFS 96

  Fly   280 ILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARR 344
            ||:..||.||.:.::.:.:..:|.|:..|..||.|...:||.|.|.:....||||:|...:...:
 Frog    97 ILEIRTVAVGIVAIKCIESEYFLAMNKSGRLYGKKSCNEDCNFRELIQENKYNTYASAKWTNNGK 161

  Fly   345 VFYLALNGSGQPRR 358
            ..::|||..|.|.:
 Frog   162 EMFVALNSKGSPMK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 38/113 (34%)
fgf7NP_001011366.1 FGF 65..189 CDD:365916 38/111 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8363
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48446
Panther 1 1.100 - - O PTHR11486
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.