DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf23

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001009564.2 Gene:fgf23 / 494456 ZFINID:ZDB-GENE-050201-4 Length:258 Species:Danio rerio


Alignment Length:212 Identity:50/212 - (23%)
Similarity:87/212 - (41%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 QPMSPAD-----NNFIGSKSKRLSNPRSSLNINSSSSNTPISNLDRNERSTVPQSHLAWTSRKIQ 252
            |.:.|||     :..:||   ...|||..:::.::|.                            
Zfish    24 QGLRPADAAPNPSPLLGS---NWGNPRRYIHLQTTSD---------------------------- 57

  Fly   253 LYIKNRILQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFT 317
              :.|..|:|...|.|..|.:..| ::::...|....|:.:..|.:..:||||..|..:.|....
Zfish    58 --LNNYYLEISPSGHVRKTTNRGS-YSVILLKTESRDRLAIFGVKSNRFLCMDTGGTLFTSTICN 119

  Fly   318 -DDCVFNENMGLQNY-NTYSSTYHSQARRVFYLALNGSGQPRRTQIPASRSLGKLSTYTNAITET 380
             :||:|:..: |:|: :.|.||.||     ..|.|:|:.|    ...|.::|.:.|.:.:. ..|
Zfish   120 KEDCLFHHKL-LENHRDVYYSTKHS-----ILLNLDGAKQ----AFIAGQNLPQSSLFLSE-KNT 173

  Fly   381 VPQERVEQLIAKNFGAN 397
            ||.||::....:|...|
Zfish   174 VPLERLQHRERRNRQVN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 33/130 (25%)
fgf23NP_001009564.2 FGF 59..164 CDD:294048 32/115 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.