DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf5

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001009561.1 Gene:fgf5 / 494454 ZFINID:ZDB-GENE-050201-6 Length:225 Species:Danio rerio


Alignment Length:179 Identity:48/179 - (26%)
Similarity:84/179 - (46%) Gaps:13/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QLYIKNRI---LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGS 313
            :||.:..|   |||..||.|||:.:.:| .::|:...|..|.|.::.|.:..:|.|:..|..:.:
Zfish    44 RLYCRVGIGFHLQIHIDGRVNGSHEPDS-LSVLELFAVSQGVIGIRGVFSNRFLAMNKRGRLHAT 107

  Fly   314 KDFTDDCVFNENMGLQNYNTYSSTYHSQAR--RVFYLALNGSGQPRRTQIPASRSLGKLSTYTNA 376
            :.|||||.|.|.....:||||:|..|...|  |.:::|||..|:.:....|..:|       .:.
Zfish   108 ESFTDDCKFRERFQENSYNTYASVIHKNHRTGREWFVALNKRGKAKMGSSPRVKS-------QHV 165

  Fly   377 ITETVPQERVEQLIAKNFGANRVKHGVRQLCDTGKPLIELIDVARFKAP 425
            .|..:|:..:.:...:.|.....:...:......||.:..::.|:...|
Zfish   166 STHFLPRMNLHEKTEQGFTVTDKEEEKQPPPHPSKPSLPKVNTAKKNRP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 41/128 (32%)
fgf5NP_001009561.1 FGF 41..170 CDD:278592 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.