DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf13b

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001315421.1 Gene:fgf13b / 403003 ZFINID:ZDB-GENE-040426-1793 Length:257 Species:Danio rerio


Alignment Length:206 Identity:59/206 - (28%)
Similarity:89/206 - (43%) Gaps:50/206 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNE 324
            ||:..||.::||::|::.|.|.....|.:..:.:|.|.|.|||.|:..|..|.|:.||.:|.|.|
Zfish    93 LQLQADGTIDGTKEEDNSFAIFNLIPVGLRVVAIQGVQTKLYLAMNNEGYLYTSEHFTPECKFKE 157

  Fly   325 NMGLQNYNTYSSTYH--SQARRVFYLALNGSGQPRRTQIPASRSLGKLSTYTNAITETVPQERVE 387
            ::....|.||||..:  .|:.|.:||.||..||..:               .|.:.:|.|     
Zfish   158 SVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGQIMK---------------GNHVKKTKP----- 202

  Fly   388 QLIAKNFGANRVKHGVRQLCDTGKPLIELIDVARFKAPP-HCSSNTSGSSSSISSSSSSSS---- 447
               |.:|              ..|||    .||.::.|. |..:..|.|.|...:.|.|:|    
Zfish   203 ---AAHF--------------IPKPL----KVAMYREPSLHDLTEFSRSGSGTPTKSRSASAMLN 246

  Fly   448 --KSSSNSSSS 456
              |:.|.:.|:
Zfish   247 GGKTLSQNEST 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 38/117 (32%)
fgf13bNP_001315421.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.