DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf1a

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_957054.1 Gene:fgf1a / 393733 ZFINID:ZDB-GENE-040426-1729 Length:147 Species:Danio rerio


Alignment Length:109 Identity:38/109 - (34%)
Similarity:57/109 - (52%) Gaps:6/109 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QLYIKNR--ILQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSK 314
            :||..|.  .||||.||.|.|..|||: ::||:......|.:.::...|.|||.|:..|..|.|.
Zfish    20 RLYCMNGGFHLQILADGTVAGAADENT-YSILRIKATSPGVVVIEGSETGLYLSMNEHGKLYASS 83

  Fly   315 DFTDDCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSGQPRR 358
            ..||:..|.|.|...:||||.|..:.:.   :|:.:..:|:.:|
Zfish    84 LVTDESYFLEKMEENHYNTYQSQKYGEN---WYVGIKKNGKMKR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 38/109 (35%)
fgf1aNP_957054.1 FGF 17..138 CDD:278592 38/109 (35%)
Heparin-binding. /evidence=ECO:0000250 117..133 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.