DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf24

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_878291.2 Gene:fgf24 / 359831 ZFINID:ZDB-GENE-030708-1 Length:208 Species:Danio rerio


Alignment Length:180 Identity:40/180 - (22%)
Similarity:64/180 - (35%) Gaps:47/180 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 QQQQQHQQQQPMSPADNNFIGSKSKRLSNPRSSLNINSSSSNTPISNLDRNERSTVPQSHLAWTS 248
            |.|:.||     |.||..|......|....|..:.|....|.|                    |.
Zfish    21 QLQESHQ-----SSADFRFYIENHTRDDVSRKQVRIYQLYSRT--------------------TG 60

  Fly   249 RKIQLYIKNRILQILRDGVVNGTQDENSEFTILQRSTVDVG-RIKLQSVATCLYLCMD----ACG 308
            :.:|:..|.          :|...|:..::.:|...|...| .::::...:..|:||:    ..|
Zfish    61 KHVQILGKK----------INANGDDGGKYALLVVETETFGSHVRIKGQESGYYICMNKNGKIIG 115

  Fly   309 VPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSGQPRR 358
            .|.|:   :.:|||.|.....||....|..:    |..||..|..|:|::
Zfish   116 KPNGN---SQECVFVEEYLENNYTALMSAKY----RGRYLGFNRKGRPKK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 27/117 (23%)
fgf24NP_878291.2 FGF 50..172 CDD:278592 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.