DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf3

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_571366.1 Gene:fgf3 / 30549 ZFINID:ZDB-GENE-980526-178 Length:256 Species:Danio rerio


Alignment Length:182 Identity:53/182 - (29%)
Similarity:88/182 - (48%) Gaps:22/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PISNLDRNERSTVPQSHLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFTILQRSTVDVGR 290
            |....|...|..| ..||....|:.:||...:. |||..:|.::|:.:||:..:||:.:.||||.
Zfish    41 PRQRRDAGGRGGV-YEHLGGAPRRRKLYCATKYHLQIHPNGKIDGSLEENNPLSILEITAVDVGV 104

  Fly   291 IKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYH---------------- 339
            :.::.:.:..||.|:..|..|.|:.|..:|.|.|.:....||||:|.:|                
Zfish   105 VAIKGLFSGRYLAMNEKGRLYASEVFNRECEFLERIHELGYNTYASRHHATTQPPPTGSGIGGSK 169

  Fly   340 --SQARRVFYLALNGSGQPRRTQIPASRSLGKLSTYTNAITETVPQERVEQL 389
              :.::|.:|:::||.|:|||..  .:||..|.|.:...:......|.|.:|
Zfish   170 RRASSKRQWYVSINGKGRPRRGF--KTRSTDKASLFLPRVLANKDHEMVRKL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 44/147 (30%)
fgf3NP_571366.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..54 4/13 (31%)
FGF 62..204 CDD:278592 44/143 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..176 1/24 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..256 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.