DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and FGF21

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_061986.1 Gene:FGF21 / 26291 HGNCID:3678 Length:209 Species:Homo sapiens


Alignment Length:104 Identity:35/104 - (33%)
Similarity:47/104 - (45%) Gaps:7/104 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDD-CVFN 323
            |:|..||.|.|..|::.| ::||...:..|.|::..|.|..:||....|..|||..|..: |.|.
Human    61 LEIREDGTVGGAADQSPE-SLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFR 124

  Fly   324 ENMGLQNYNTYSSTYHSQARRVFYLALNGSGQPRRTQIP 362
            |.:....||.|.|..|.     ..|.|.|:..|.|...|
Human   125 ELLLEDGYNVYQSEAHG-----LPLHLPGNKSPHRDPAP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 35/104 (34%)
FGF21NP_061986.1 FGF 47..159 CDD:412137 35/104 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..209 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.