DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf9

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_037084.1 Gene:Fgf9 / 25444 RGDID:2610 Length:208 Species:Rattus norvegicus


Alignment Length:188 Identity:57/188 - (30%)
Similarity:91/188 - (48%) Gaps:31/188 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 NTPI----------SNLDRNERSTVPQ-------SHLAWTSRKIQLYIKNRI-LQILRDGVVNGT 271
            |.|:          .:|.::|...:|:       .||....|:.|||.:... |:|..:|.:.||
  Rat    21 NVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGT 85

  Fly   272 QDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSS 336
            :.::|.|.||:..::.||.:.::.|.:.|||.|:..|..|||:..|.:|||.|......||||||
  Rat    86 RKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSS 150

  Fly   337 TY--HSQARRVFYLALNGSGQPR---RTQIPASRSLGKLSTYTNAITETVPQERVEQL 389
            ..  |....|.:|:|||..|.||   ||:        :...:|:.:...|..::|.:|
  Rat   151 NLYKHVDTGRRYYVALNKDGTPREGTRTK--------RHQKFTHFLPRPVDPDKVPEL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 47/134 (35%)
Fgf9NP_037084.1 FGF 62..188 CDD:395115 47/133 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8202
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm45368
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.