DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and FGF11

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_004103.1 Gene:FGF11 / 2256 HGNCID:3667 Length:225 Species:Homo sapiens


Alignment Length:135 Identity:42/135 - (31%)
Similarity:64/135 - (47%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNE 324
            ||...||.:.||.::.|.||......|.:..:.:||.....|:.|:|.|:.|.|..||.:|.|.|
Human    83 LQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKE 147

  Fly   325 NMGLQNYNTYSSTYHSQAR--RVFYLALNGSGQ------PRRTQIPASRSLGKL---STYTNAIT 378
            .:....|..|:|..:.|.|  |.:||.|:..||      .::|: .|:..|.||   :.|.....
Human   148 CVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTK-AAAHFLPKLLEVAMYQEPSL 211

  Fly   379 ETVPQ 383
            .:||:
Human   212 HSVPE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 40/126 (32%)
FGF11NP_004103.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
FGF 69..199 CDD:214665 37/116 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8338
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41236
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.