DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and FGF8

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_149353.1 Gene:FGF8 / 2253 HGNCID:3686 Length:244 Species:Homo sapiens


Alignment Length:152 Identity:37/152 - (24%)
Similarity:65/152 - (42%) Gaps:22/152 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SNPRSSLNINSSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLYIK--NRILQILRDGVVNGTQD 273
            |:|..:.::...|..|     |:..|..:         |..|||.:  .:.:|:|.:..:|...:
Human    57 SSPNFTQHVREQSLVT-----DQLSRRLI---------RTYQLYSRTSGKHVQVLANKRINAMAE 107

  Fly   274 ENSEFTILQRSTVDVG-RIKLQSVATCLYLCMDACG-VPYGSKDFTDDCVFNENMGLQNYNTYSS 336
            :...|..|...|...| |::::...|.||:||:..| :...|.....||||.|.:...||....:
Human   108 DGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQN 172

  Fly   337 TYHSQARRVFYLALNGSGQPRR 358
            ..:..    :|:|....|:||:
Human   173 AKYEG----WYMAFTRKGRPRK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 31/116 (27%)
FGF8NP_149353.1 FGF 81..204 CDD:395115 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.