DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and FGF5

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_004455.2 Gene:FGF5 / 2250 HGNCID:3683 Length:268 Species:Homo sapiens


Alignment Length:241 Identity:74/241 - (30%)
Similarity:115/241 - (47%) Gaps:36/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 QPMSPA--DNNFIGSKSKRLSNPRSSLNINSSSSNTPISNLDRNERSTVPQSHLAWT---SRKIQ 252
            || .||  |.|..||.|::.|   ||...:||:|::|.::|. ::.|.:.||...|:   .|...
Human    31 QP-GPAATDRNPRGSSSRQSS---SSAMSSSSASSSPAASLG-SQGSGLEQSSFQWSPSGRRTGS 90

  Fly   253 LYIKNRI---LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSK 314
            ||.:..|   |||..||.|||:.:.|. .::|:...|..|.:.::.|.:..:|.|...|..:.|.
Human    91 LYCRVGIGFHLQIYPDGKVNGSHEANM-LSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASA 154

  Fly   315 DFTDDCVFNENMGLQNYNTYSSTYH--SQARRVFYLALNGSGQPRRTQIPASRSLGKLSTY---- 373
            .|||||.|.|.....:||||:|..|  .:..|.:|:|||..|:.:|...|..:. ..:||:    
Human   155 KFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKP-QHISTHFLPR 218

  Fly   374 -------TNAITETVPQERVE--------QLIAKNFGANRVKHGVR 404
                   ..:.|.|||:::..        .|.|.....|.||:.::
Human   219 FKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 44/147 (30%)
FGF5NP_004455.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..81 20/54 (37%)
FGF 87..216 CDD:395115 44/130 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..255 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8338
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41236
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.