DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and FGF4

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001998.1 Gene:FGF4 / 2249 HGNCID:3682 Length:206 Species:Homo sapiens


Alignment Length:144 Identity:40/144 - (27%)
Similarity:69/144 - (47%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 HLAWTSRKIQLYIKNRI---LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCM 304
            :|....|..:||....|   ||.|.||.:.|...:..: ::|:.|.|:.|.:.:..||:..::.|
Human    76 YLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRD-SLLELSPVERGVVSIFGVASRFFVAM 139

  Fly   305 DACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSGQPRRTQIPASRSLGK 369
            .:.|..|||..|||:|.|.|.:...|||.|.|..:..    .::||:.:|:.::         |.
Human   140 SSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPG----MFIALSKNGKTKK---------GN 191

  Fly   370 LSTYTNAITETVPQ 383
            ..:.|..:|..:|:
Human   192 RVSPTMKVTHFLPR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 37/131 (28%)
FGF4NP_001998.1 FGF 82..203 CDD:395115 38/134 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41236
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.