DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and FGF3

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_005238.1 Gene:FGF3 / 2248 HGNCID:3681 Length:239 Species:Homo sapiens


Alignment Length:236 Identity:59/236 - (25%)
Similarity:97/236 - (41%) Gaps:54/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 HLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDA 306
            ||....|:.:||...:. ||:...|.|||:. |||.::||:.:.|:||.:.::.:.:..||.|:.
Human    38 HLGGAPRRRKLYCATKYHLQLHPSGRVNGSL-ENSAYSILEITAVEVGIVAIRGLFSGRYLAMNK 101

  Fly   307 CGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYH------------SQARRVFYLALNGSGQPRRT 359
            .|..|.|:.::.:|.|.|.:....||||:|..:            ..|.|::|:::||.|:|||.
Human   102 RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRG 166

  Fly   360 QIPASRSLGKLSTYTNAITETVPQERVEQLIAKNFGANRVKHGVRQLCDTGKPLIELIDVARFKA 424
            .  .:|...|.|.:...:.:....|.|.||                  .:|.|           .
Human   167 F--KTRRTQKSSLFLPRVLDHRDHEMVRQL------------------QSGLP-----------R 200

  Fly   425 PPHCSSNTSGSSSSISSSSSSSSKSSSNSSSSYVPVSAISS 465
            ||         ...:........:|..|...|:|..|.:.|
Human   201 PP---------GKGVQPRRRRQKQSPDNLEPSHVQASRLGS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 43/141 (30%)
FGF3NP_005238.1 FGF 44..179 CDD:395115 43/137 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..239 12/78 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8338
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm41236
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.