DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and FGF2

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001997.5 Gene:FGF2 / 2247 HGNCID:3676 Length:288 Species:Homo sapiens


Alignment Length:118 Identity:39/118 - (33%)
Similarity:56/118 - (47%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PQSHLAWTSRKIQLYIKNR--ILQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYL 302
            |..|.....|   ||.||.  .|:|..||.|:|.::::.....||....:.|.:.::.|....||
Human   155 PPGHFKDPKR---LYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYL 216

  Fly   303 CMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSGQ 355
            .|...|....||..||:|.|.|.:...|||||.|..::.    :|:||..:||
Human   217 AMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTS----WYVALKRTGQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 37/111 (33%)
FGF2NP_001997.5 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
FGF 161..282 CDD:278592 37/112 (33%)
Cell attachment site, atypical. /evidence=ECO:0000255 179..181 1/1 (100%)
Cell attachment site, atypical. /evidence=ECO:0000255 221..223 0/1 (0%)
Heparin-binding. /evidence=ECO:0000250 261..277 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.