DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf3

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_570830.1 Gene:Fgf3 / 170633 RGDID:620126 Length:245 Species:Rattus norvegicus


Alignment Length:252 Identity:60/252 - (23%)
Similarity:105/252 - (41%) Gaps:59/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 HLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDA 306
            ||....|:.:||...:. ||:...|.|||:. |||.::||:.:.|:||.:.::.:.:..||.|:.
  Rat    38 HLGGAPRRRKLYCATKYHLQLHPSGRVNGSL-ENSAYSILEITAVEVGVVAIKGLFSGRYLAMNK 101

  Fly   307 CGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQ------------ARRVFYLALNGSGQPRRT 359
            .|..|.|:.:..:|.|.|.:....||||:|..:..            |:|.:|:::||.|:||| 
  Rat   102 RGRLYASEHYNAECEFVERIHELGYNTYASRLYRTGPSGPGARRQPGAQRPWYVSVNGKGRPRR- 165

  Fly   360 QIPASRSLGKLSTYTNAITETVPQERVEQLIAKNFGANRVKHGVRQLCDTGKPLIELIDVARFKA 424
                    |..:..|...:..:|  ||         .....|.:.:|..:|:|          :|
  Rat   166 --------GFKTRRTQKSSLFLP--RV---------LGHKDHEMVRLLQSGQP----------QA 201

  Fly   425 PPHCSSNTSGSSSSISSSSSSSSKSSSNSSSSYVPVSAISSLSSISNSSQSESGHIS 481
            |        |..|..............:....::|..|       :.|:|.::|.::
  Rat   202 P--------GEGSQPRQRRQKKQSPGDHGKMEHLPTKA-------TTSAQLDTGGLA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 42/141 (30%)
Fgf3NP_570830.1 FGF 44..179 CDD:395115 42/144 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8202
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm45368
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.