DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf11

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_038941039.1 Gene:Fgf11 / 170632 RGDID:620162 Length:233 Species:Rattus norvegicus


Alignment Length:216 Identity:55/216 - (25%)
Similarity:83/216 - (38%) Gaps:57/216 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 RNERSTVPQSHLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFT----ILQR--STVDVGR 290
            |.:|...||.....|    :|:.:... ||...||.:.||.::.|.|:    .||.  :.:.||.
  Rat    59 RQDRGPEPQLKGIVT----KLFCRQGFYLQANPDGSIQGTPEDTSSFSEKGHQLQAHFNLIPVGL 119

  Fly   291 --IKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQAR--RVFYLALN 351
              :.:||.....|:.|:|.|:.|.|..||.:|.|.|.:....|..|:|..:.|.|  |.:||.|:
  Rat   120 RVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLD 184

  Fly   352 GSGQPRRTQIPASRSLGKLSTYTNAITETVPQERVEQLIAKNFGANRVKHGVRQLCDTGKPLIEL 416
            ..|:..:         |.....|.|....||                                :|
  Rat   185 KEGRVMK---------GNRVKKTKAAAHFVP--------------------------------KL 208

  Fly   417 IDVARFKAPP-HCSSNTSGSS 436
            ::||.::.|. |....||.||
  Rat   209 LEVAMYREPSLHSVPETSPSS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 39/139 (28%)
Fgf11XP_038941039.1 FGF 69..207 CDD:214665 42/182 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.