DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf8

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_036017324.1 Gene:Fgf8 / 14179 MGIID:99604 Length:308 Species:Mus musculus


Alignment Length:269 Identity:53/269 - (19%)
Similarity:96/269 - (35%) Gaps:64/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QTQTQTQIQSQYPSQAEDSDQL-----EEPLGFVISAMPNEHLAVLSRTERSIRHQNQQQQKKHH 178
            |.|.::..|.:.|.....:|.|     :.|.|                 :||...:|......::
Mouse    21 QAQVRSAAQKRGPGAGNPADTLGQGHEDRPFG-----------------QRSRAGKNFTNPAPNY 68

  Fly   179 HHHQQQQQQQH---QQQQPMSPADNNFIGSKSKRL-----------------SNPRSSLNINSSS 223
            .....::|:..   :..|...|.....:|.:...|                 |:|..:.::...|
Mouse    69 PEEGSKEQRDSVLPKVTQREGPGGGPALGREPTSLLRAGREPQGVSQQVTVQSSPNFTQHVREQS 133

  Fly   224 SNTPISNLDRNERSTVPQSHLAWTSRKIQLYIK--NRILQILRDGVVNGTQDENSEFTILQRSTV 286
            ..|     |:..|..:         |..|||.:  .:.:|:|.:..:|...::...|..|...|.
Mouse   134 LVT-----DQLSRRLI---------RTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETD 184

  Fly   287 DVG-RIKLQSVATCLYLCMDACG-VPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARRVFYLA 349
            ..| |::::...|.||:||:..| :...|.....||||.|.:...||....:..:..    :|:|
Mouse   185 TFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEG----WYMA 245

  Fly   350 LNGSGQPRR 358
            ....|:||:
Mouse   246 FTRKGRPRK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 31/116 (27%)
Fgf8XP_036017324.1 FGF 145..268 CDD:395115 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.