DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf4

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_034332.2 Gene:Fgf4 / 14175 MGIID:95518 Length:202 Species:Mus musculus


Alignment Length:144 Identity:39/144 - (27%)
Similarity:68/144 - (47%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 HLAWTSRKIQLYIKNRI---LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCM 304
            :|....|..:||....|   ||:|.||.:.|...:..: ::|:.|.|..|.:.:..||:..::.|
Mouse    72 YLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRD-SLLELSPVQRGVVSIFGVASRFFVAM 135

  Fly   305 DACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSGQPRRTQIPASRSLGK 369
            .:.|..:|...|||:|.|.|.:...|||    .|.|.|....::||:.:|:.::         |.
Mouse   136 SSRGKLFGVPFFTDECKFKEILLPNNYN----AYESYAYPGMFMALSKNGRTKK---------GN 187

  Fly   370 LSTYTNAITETVPQ 383
            ..:.|..:|..:|:
Mouse   188 RVSPTMKVTHFLPR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 36/131 (27%)
Fgf4NP_034332.2 FGF 83..199 CDD:395115 35/129 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.