DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf3

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_032033.2 Gene:Fgf3 / 14174 MGIID:95517 Length:245 Species:Mus musculus


Alignment Length:129 Identity:42/129 - (32%)
Similarity:69/129 - (53%) Gaps:14/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 HLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDA 306
            ||....|:.:||...:. ||:...|.|||:. |||.::||:.:.|:||.:.::.:.:..||.|:.
Mouse    38 HLGGAPRRRKLYCATKYHLQLHPSGRVNGSL-ENSAYSILEITAVEVGVVAIKGLFSGRYLAMNK 101

  Fly   307 CGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQ------------ARRVFYLALNGSGQPRR 358
            .|..|.|..:..:|.|.|.:....||||:|..:..            |:|.:|:::||.|:|||
Mouse   102 RGRLYASDHYNAECEFVERIHELGYNTYASRLYRTGSSGPGAQRQPGAQRPWYVSVNGKGRPRR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 40/125 (32%)
Fgf3NP_032033.2 FGF 44..179 CDD:395115 40/123 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..181 9/29 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8324
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm43297
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.