DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf2

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_036018787.1 Gene:Fgf2 / 14173 MGIID:95516 Length:176 Species:Mus musculus


Alignment Length:157 Identity:33/157 - (21%)
Similarity:51/157 - (32%) Gaps:57/157 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLYIKNR--ILQILRDGVVNGTQDENSEFTILQR 283
            ::|..|.:..|..:..:..|..|.....|   ||.||.  .|:|..||.|:|.::::        
Mouse     2 AASGITSLPALPEDGGAAFPPGHFKDPKR---LYCKNGGFFLRIHPDGRVDGVREKS-------- 55

  Fly   284 STVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTY---------- 338
                                 |....|.|.:.|       :::.|:|:.....||          
Mouse    56 ---------------------DPHAPPAGDQAF-------KHVSLRNHERKDVTYKRRRASMFIN 92

  Fly   339 ---HSQARRVFYLALNGSGQPRRTQIP 362
               ||...|   ||.|..|..|...:|
Mouse    93 MLGHSSTMR---LAANSVGWVRGRTLP 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 28/131 (21%)
Fgf2XP_036018787.1 FGF 28..>59 CDD:412137 12/62 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.